Recombinant Full Length Escherichia Coli Miniconductance Mechanosensitive Channel(Mscm) Protein, His-Tagged
Cat.No. : | RFL18428EF |
Product Overview : | Recombinant Full Length Escherichia coli Miniconductance mechanosensitive channel(mscM) Protein (P0AAT4) (1-415aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-415) |
Form : | Lyophilized powder |
AA Sequence : | MQDLISQVEDLAGIEIDHTTSMVMIFGIIFLTAVVVHIILHWVVLRTFEKRAIASSRLWL QIITQNKLFHRLAFTLQGIIVNIQAVFWLQKGTEAADILTTCAQLWIMMYALLSVFSLLD VILNLAQKFPAASQLPLKGIFQGIKLIGAILVGILMISLLIGQSPAILISGLGAMAAVLM LVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDIGLTTVKVRNWDNTITTIP TWSLVSDSFKNWSGMSASGGRRIKRSISIDVTSIRFLDEDEMQRLNKAHLLKPYLTSRHQ EINEWNRQQGSTESVLNLRRMTNIGTFRAYLNEYLRNHPRIRKDMTLMVRQLAPGDNGLP LEIYAFTNTVVWLEYESIQADIFDHIFAIVEEFGLRLHQSPTGNDIRSLAGAFKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybdG |
Synonyms | ybdG; mscM; b0577; JW0566; Miniconductance mechanosensitive channel YbdG |
UniProt ID | P0AAT4 |
◆ Recombinant Proteins | ||
WTAP-3744H | Recombinant Human WTAP, GST-tagged | +Inquiry |
ABHD10-2400H | Recombinant Human Abhydrolase Domain Containing 10, His-tagged | +Inquiry |
TAF6L-3106H | Recombinant Human TAF6L, GST-tagged | +Inquiry |
NRG1-183H | Active Recombinant Human NRG1 | +Inquiry |
Lancl2-3752M | Recombinant Mouse Lancl2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-62B | Native Bovine Collagen Type XI | +Inquiry |
IgG-340G | Native Goat IgG | +Inquiry |
Lectin-1845S | Active Native Soybean Agglutinin Protein, Agarose bound | +Inquiry |
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
IgG-008G | Native Guinea Pig Whole Molecule IgG, Biotin Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM24-2476HCL | Recombinant Human RBM24 293 Cell Lysate | +Inquiry |
CFAP44-342HCL | Recombinant Human WDR52 293 Cell Lysate | +Inquiry |
EHMT1-6685HCL | Recombinant Human EHMT1 293 Cell Lysate | +Inquiry |
CRYGA-203HCL | Recombinant Human CRYGA lysate | +Inquiry |
COX4NB-7333HCL | Recombinant Human COX4NB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ybdG Products
Required fields are marked with *
My Review for All ybdG Products
Required fields are marked with *
0
Inquiry Basket