Recombinant Full Length Yersinia Pestis Bv. Antiqua Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL33941YF |
Product Overview : | Recombinant Full Length Yersinia pestis bv. Antiqua Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q1CGH0) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis bv. Antiqua |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MMNDKDLSTWQTFRRLWPTISPYKAGLIVAAIALILNAASDTFMLSLLKPLLDDGFGNSN SSILKWMPLAVIGLMVVRGVTGFVSSYCISWVSGKVVMHIRRRLFSHMMGMPVSFFDQQS TGTLLSRITYDSEQVAASSSSALVTVVREGASIIGLFIMMFYYSWQLSLILIVIAPIVSI SIRLVSKRFRNISKNMQNTMGEVTTSAEQMLKGHKEVLIFGGQKVETERFDAVSNRMRQQ GMKLVSASSISDPIIQLIASFALALVLYAASFPSVMETLTAGTITVVFSAMIALMRPLKS LTNVNTQFQRGMAACQTLFSILDMEQEKDEGKLEVERAKGDIEFRHVTFYYPGKDTPALN DINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYRLGALRNQVA LVSQNVHLFNDTVANNIAYARNEQYSRAEIEEAARMAYAMDFINKMEHGLDTVIGENGIM LSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVIEDGRIVERGVHAELLVQQGVYAQLNRMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; YPN_2582; YP516_2909; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q1CGH0 |
◆ Recombinant Proteins | ||
BDNF-258H | Recombinant Human BDNF protein | +Inquiry |
RFL32117BF | Recombinant Full Length Burkholderia Mallei Protein Crcb Homolog(Crcb) Protein, His-Tagged | +Inquiry |
EIF2AK2-3149H | Recombinant Human EIF2AK2 Protein, GST-tagged | +Inquiry |
FOXP1-2044R | Recombinant Rat FOXP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SYT5-4425H | Recombinant Human SYT5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
CTSG-8070H | Native Human Neutrophil Cathepsin G Biotinylated | +Inquiry |
CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
CP-8075R | Native Rat Serum Ceruloplasmin | +Inquiry |
IgM-337G | Native Goat IgM | +Inquiry |
APOC1-27330TH | Native Human APOC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA10-1810MCL | Recombinant Mouse CA10 cell lysate | +Inquiry |
VPS54-1917HCL | Recombinant Human VPS54 cell lysate | +Inquiry |
FXN-6108HCL | Recombinant Human FXN 293 Cell Lysate | +Inquiry |
PCDHGA1-3389HCL | Recombinant Human PCDHGA1 293 Cell Lysate | +Inquiry |
MXI1-4046HCL | Recombinant Human MXI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket