Recombinant Full Length Lepidium Virginicum Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL32989LF |
Product Overview : | Recombinant Full Length Lepidium virginicum Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A4QLD2) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lepidium virginicum (Virginia pepperweed) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A4QLD2 |
◆ Recombinant Proteins | ||
CYP2A26-183C | Recombinant Cynomolgus Monkey CYP2A26 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pdk3-8051M | Recombinant Mouse Pdk3 protein, His-tagged | +Inquiry |
GNL1-4642Z | Recombinant Zebrafish GNL1 | +Inquiry |
RAB13-3732R | Recombinant Rhesus monkey RAB13 Protein, His-tagged | +Inquiry |
POP4-13125M | Recombinant Mouse POP4 Protein | +Inquiry |
◆ Native Proteins | ||
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
TG-121B | Native Bovine TG | +Inquiry |
ELANE-8236H | Native Human Neutrophil Elastase (ELA-2) | +Inquiry |
AK-14B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM9-1750MCL | Recombinant Mouse ADAM9 cell lysate | +Inquiry |
PRELP-001HCL | Recombinant Human PRELP cell lysate | +Inquiry |
SLC6A7-1703HCL | Recombinant Human SLC6A7 293 Cell Lysate | +Inquiry |
C20orf195-8121HCL | Recombinant Human C20orf195 293 Cell Lysate | +Inquiry |
DTX3-6793HCL | Recombinant Human DTX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket