Recombinant Full Length Liriodendron Tulipifera Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL26900LF |
Product Overview : | Recombinant Full Length Liriodendron tulipifera Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q0G9J3) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Liriodendron tulipifera (Tuliptree) (Tulip poplar) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGINNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGHELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q0G9J3 |
◆ Recombinant Proteins | ||
ZNF383-1102C | Recombinant Cynomolgus ZNF383 Protein, His-tagged | +Inquiry |
TAF7-9533Z | Recombinant Zebrafish TAF7 | +Inquiry |
RFL19991MF | Recombinant Full Length Mouse Surfeit Locus Protein 4(Surf4) Protein, His-Tagged | +Inquiry |
TM2D2-4739R | Recombinant Rhesus monkey TM2D2 Protein, His-tagged | +Inquiry |
GJC3-3578M | Recombinant Mouse GJC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
AFP-3017H | Native Human fetal cord serum | +Inquiry |
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
Cry1Ab-523 | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
Fga-63R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSBP2-1464HCL | Recombinant Human SSBP2 293 Cell Lysate | +Inquiry |
RGS16-2383HCL | Recombinant Human RGS16 293 Cell Lysate | +Inquiry |
CHST11-001HCL | Recombinant Human CHST11 cell lysate | +Inquiry |
C10orf35-8366HCL | Recombinant Human C10orf35 293 Cell Lysate | +Inquiry |
IGROV1-056WCY | Human Ovarian Carcinoma IGROV1 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket