Recombinant Full Length Acorus Calamus Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL35658AF |
Product Overview : | Recombinant Full Length Acorus calamus Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q3V508) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Acorus calamus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKIGDPTTRRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q3V508 |
◆ Recombinant Proteins | ||
NKX2-3-10699M | Recombinant Mouse NKX2-3 Protein | +Inquiry |
AKAP5-3030H | Recombinant Human AKAP5, His-tagged | +Inquiry |
MARS-2504R | Recombinant Rhesus Macaque MARS Protein, His (Fc)-Avi-tagged | +Inquiry |
PML-3301R | Recombinant Rhesus Macaque PML Protein, His (Fc)-Avi-tagged | +Inquiry |
GZMA-7410M | Recombinant Mouse GZMA Protein | +Inquiry |
◆ Native Proteins | ||
C5-10540H | Active Native Human C5 | +Inquiry |
A1m-367M | Native Mouse A1m | +Inquiry |
LYPL-29 | Active Native Lysophospholipase | +Inquiry |
LTF-230B | Native Bovine Apo-Lactoferrin | +Inquiry |
IgG-355S | Native Sheep IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
ILKAP-1855HCL | Recombinant Human ILKAP cell lysate | +Inquiry |
ACADVL-9111HCL | Recombinant Human ACADVL 293 Cell Lysate | +Inquiry |
NTRK2-1024CCL | Recombinant Canine NTRK2 cell lysate | +Inquiry |
CKLF-7484HCL | Recombinant Human CKLF 293 Cell Lysate | +Inquiry |
KCNK6-5032HCL | Recombinant Human KCNK6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket