Recombinant Full Length Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL35675CF |
Product Overview : | Recombinant Full Length Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (O19928) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanidium caldarium (Red alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MALPWYRVHTVVLNDPGRLISVHLMHTALVSGWAGSMALYELAVFDPSDPVLNPMWRQGM FVMPFMARLGVTDSWGGWSITGESVSNPGLWSFEGVALTHIVLSGLLFLASIWHWVYWDL DLFRDPRTLEPALDLPKVFGIHLVLSSLLCFGFGAFHVTGLFGPGIWISDAYGLTGRIQS VAPAWGPEGFNPFNPGGIASHHIAAGTVGILAGVFHLNVRPPQRLYRALRMGNIETVLSS SIAAVFFASFVVSGTMWYGAASTPIELFGPTRYQWDSGYFQQEIEKRVEESLSNGLSLPE AWSNIPDKLAFYDYIGNNPAKGGLFRAGPMNKGDGIAEAWLGHPVFQDKEGHELIVRRMP AFFENFPIILVDKDGIIRADIPFRRAESKYSIEQVGVTCSFYGGKLNNQSFKDASTVKKY ARKAQFGEVFEFDRTILDSDGVFRSSPRGWFTFGHANFALLFFFGHLWHGSRTLFRDVFA GIGAEVTEQVEFGVFQKVGDKTTKKQGYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | O19928 |
◆ Recombinant Proteins | ||
FAM89B-3812H | Recombinant Human FAM89B Protein, GST-tagged | +Inquiry |
ZNF512-10435M | Recombinant Mouse ZNF512 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cxcl12-371M | Recombinant Mouse Chemokine (C-X-C motif) Ligand 12 | +Inquiry |
SPACA9-2729HF | Recombinant Full Length Human SPACA9 Protein, GST-tagged | +Inquiry |
RFL20719EF | Recombinant Full Length Maltose Transport System Permease Protein Malg(Malg) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
H3N20194-213I | Native H3N2 (A/Kiev/301/94) H3N20194 protein | +Inquiry |
ELANE-3221H | Active Native Human ELANE Protein | +Inquiry |
Lectin-1858V | Active Native Vicia Villosa Lectin Protein | +Inquiry |
FGG -41B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
Hyaluronidase-39O | Active Native Ovine Hyaluronidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLVRB-8440HCL | Recombinant Human BLVRB 293 Cell Lysate | +Inquiry |
PTPRE-2676HCL | Recombinant Human PTPRE 293 Cell Lysate | +Inquiry |
DGUOK-6952HCL | Recombinant Human DGUOK 293 Cell Lysate | +Inquiry |
ATOX1-8616HCL | Recombinant Human ATOX1 293 Cell Lysate | +Inquiry |
Colon-666H | Hamster Colon Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket