Recombinant Full Length Invertebrate Iridescent Virus 3 Putative Myristoylated Protein 006R(Iiv3-006R) Protein, His-Tagged
Cat.No. : | RFL31004IF |
Product Overview : | Recombinant Full Length Invertebrate iridescent virus 3 Putative myristoylated protein 006R(IIV3-006R) Protein (Q197F4) (2-494aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-494) |
Form : | Lyophilized powder |
AA Sequence : | GSSVSKNISKVATEALARASSDILLQTDLTTDQTQVISVSDVGGDVVISGNEFIQKATIN MKALMNALIQENVQQNLTLQIAQAAKSIVSGFNMFQLPNAQNEIDLFVRASIELVNTISQ VCTSSVSENYLIDIKRVKGSVRIQNNTVRQFVDIFGSCVQNAVASNAIFQDLQAKLDQSA TSKADGLTLWQVAALVAIVLGVPVVSVIGGIAVAGRWMFPISILAGAGCLVVWSSQANTT MADHAFSRFVRNTSDCLGTALGPVLQTLPNSNAAAQSCLSNADCVAFDWQGTVVDDKGTN KVLTPPQTTFYNKVSSICEQAVKSNPDTTRLVRLPIFAKGVGSPQSKASPPADVYLDTAT TNYYFFDPPTNMWVKQGTFAHAEWSAAKNQIDWGTITPTVSTPGTPGNIYVYYGSDNPIY FYVYVKTADSWSLYTPTLRGPGLVTDTPATINVSGFKVNQRRQWLLYLGVALIIVGIFGS ILAFNSRRPEERK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IIV3-006R |
Synonyms | IIV3-006R; Putative myristoylated protein 006R |
UniProt ID | Q197F4 |
◆ Native Proteins | ||
Tf-392R | Native Rat Transferrin | +Inquiry |
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
Trypsin-265H | Native Human Trypsin | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
Thrombin-24H | Active Native Human a-Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RUNX1T1-2110HCL | Recombinant Human RUNX1T1 293 Cell Lysate | +Inquiry |
PPP4R4-2909HCL | Recombinant Human PPP4R4 293 Cell Lysate | +Inquiry |
RBFOX2-2464HCL | Recombinant Human RBM9 293 Cell Lysate | +Inquiry |
DDX11-454HCL | Recombinant Human DDX11 cell lysate | +Inquiry |
TIMM13-1072HCL | Recombinant Human TIMM13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IIV3-006R Products
Required fields are marked with *
My Review for All IIV3-006R Products
Required fields are marked with *
0
Inquiry Basket