Recombinant Human FHIT Protein, GST-tagged

• Cat.No.: FHIT-4159H
• Product Overview: Human FHIT partial ORF ( AAH32336, 31 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene, a member of the histidine triad gene family, encodes a diadenosine 5,5-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FHIT fragile histidine triad [ Homo sapiens ]
• Official Symbol: FHIT
• Synonyms: FHIT; fragile histidine triad; fragile histidine triad gene; bis(5-adenosyl)-triphosphatase; AP3Aase; FRA3B; AP3A hydrolase; tumor suppressor protein; dinucleosidetriphosphatase; diadenosine 5,5-P1,P3-triphosphate hydrolase
• Gene ID: 2272
• mRNA Refseq: NM_001166243
• Protein Refseq: NP_001159715
• MIM: 601153
• UniProt ID: P49789