Recombinant Human PPP2R3B Protein (1-176 aa), His-SUMO-tagged

• Cat.No.: PPP2R3B-1165H
• Product Overview: Recombinant Human PPP2R3B Protein (1-176 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Isoform 2.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-176 aa
• Description: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 36.1 kDa
• AA Sequence: MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: PPP2R3B protein phosphatase 2, regulatory subunit B, beta [ Homo sapiens ]
• Official Symbol: PPP2R3B
• Synonyms: PPP2R3B; PPP2R3LY; PR48; NYREN8; PPP2R3L; FLJ60425
• Gene ID: 28227
• mRNA Refseq: NM_013239
• Protein Refseq: NP_037371
• MIM: 300339
• UniProt ID: Q9Y5P8