Recombinant Full Length Illicium Oligandrum Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL32773IF |
Product Overview : | Recombinant Full Length Illicium oligandrum Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A6MMX0) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Illicium oligandrum (Star anise) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGTGLAENLSLSE AWSKIPDKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKDGHELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYGDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A6MMX0 |
◆ Recombinant Proteins | ||
CDC42-2637H | Recombinant Human CDC42(Q61L) protein, His-tagged | +Inquiry |
JPH3-8432M | Recombinant Mouse JPH3 Protein | +Inquiry |
RIMBP2-5828C | Recombinant Chicken RIMBP2 | +Inquiry |
RFL12633SF | Recombinant Full Length Saccharomyces Cerevisiae Cytochrome B Mrna Maturase Bi2(Bi2) Protein, His-Tagged | +Inquiry |
CAPZB-2854HF | Recombinant Full Length Human CAPZB Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
dsbA-8328E | Native E.coli dsbA | +Inquiry |
C4-195H | Native Human Complement C4c | +Inquiry |
Lectin-1723C | Native Canavalia ensiformis Lectin, FITC conjugated | +Inquiry |
FABP-178R | Native Rat Fatty acid Binding Protein | +Inquiry |
Placenta-020H | Human Placenta Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMD14-2751HCL | Recombinant Human PSMD14 293 Cell Lysate | +Inquiry |
TREM2-2649HCL | Recombinant Human TREM2 cell lysate | +Inquiry |
RHBDL2-1503HCL | Recombinant Human RHBDL2 cell lysate | +Inquiry |
ANAPC11-8869HCL | Recombinant Human ANAPC11 293 Cell Lysate | +Inquiry |
MAD2L2-4567HCL | Recombinant Human MAD2L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket