Recombinant Full Length Gossypium Hirsutum Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL34502GF |
Product Overview : | Recombinant Full Length Gossypium hirsutum Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q2L932) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gossypium hirsutum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKDGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q2L932 |
◆ Recombinant Proteins | ||
TMOD3-4852R | Recombinant Rhesus monkey TMOD3 Protein, His-tagged | +Inquiry |
cre-145B | Recombinant Bacteriophage P1 cre protein, T7/His-tagged | +Inquiry |
GRHL2-5327H | Recombinant Human GRHL2 Protein, MYC/DDK-tagged | +Inquiry |
DRG2-1332R | Recombinant Rhesus monkey DRG2 Protein, His-tagged | +Inquiry |
ADGRA2-1086H | Recombinant Human ADGRA2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Avidin Biotin-27 | Native Avidin Protein | +Inquiry |
Streptavidin-24 | Streptavidin | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
COL2A1-15C | Native Chicken COL2A1 Protein | +Inquiry |
KRT19-382H | Native Human KRT19 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1B2-6714HCL | Recombinant Human EEF1B2 293 Cell Lysate | +Inquiry |
MTAP-424HCL | Recombinant Human MTAP lysate | +Inquiry |
HIST1H4K-5519HCL | Recombinant Human HIST1H4K 293 Cell Lysate | +Inquiry |
FOLR3-6169HCL | Recombinant Human FOLR3 293 Cell Lysate | +Inquiry |
WISP1-308HCL | Recombinant Human WISP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket