Recombinant Full Length Guillardia Theta Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL24202GF |
Product Overview : | Recombinant Full Length Guillardia theta Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (O78511) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guillardia theta (Cryptomonas phi) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYELAVFDPSDPVLNPMWRQGM YVMPFMARIGVTDSWGGWSITGESVSNPGFWSFEGVALAHIGLSGLLFLAAVWHWVYWDL ELFRDPRTGNPALDLPKIFGIHLVLAGLLCFGFGAFHVTGAWGPGIWVSDAYGITGKVQP VAPTWGPEGFNPFNPSGVASHHIAAGILGFIAGIFHIAVRPPQRLYRALRMGNIETVLSS SIAAVFFAAFITTGTMWYGSATTPIELFGPTRYQWDSGYFQQEIERRVENSLNEGLSLSE AWSRIPDKLAFYDYVGNNPAKGGLFRAGPMNKGDGIAEAWLGHPVFQDKEGRELTVRRMP AFFETFPVILVDKDGIIRADIPFRRAESKYSVEQVGVTVSFYGGKLNGQTYTDAPTVKKY ARKAQLGEVLEFDRTTLESDGVFRSSPRGWYTFGHANFALLFFLGHLWHGSRTLFRDVFS GIGAEVTEQVEFGAFQKLGDRSTKKQGAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | O78511 |
◆ Recombinant Proteins | ||
GPR183-5503HF | Recombinant Full Length Human GPR183 Protein | +Inquiry |
MARCH3-2499R | Recombinant Rhesus Macaque MARCH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HA-0375H | Recombinant Influenza A H7N9 (A/Hangzhou/1/2013) HA protein, His-tagged | +Inquiry |
HIST3H2A-260H | Recombinant Human HIST3H2A protein(Met1-Lys130) | +Inquiry |
RFL25663SF | Recombinant Full Length Salmonella Enteritidis Pt4 Arginine Exporter Protein Argo(Argo) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
VTN-384B | Native Bovine Vitronectin | +Inquiry |
Fibrinogen-71R | Active Native Rabbit Fibrinogen | +Inquiry |
CTSG-5327H | Native Human Cathepsin G | +Inquiry |
Factor 4-88H | Native Human Platelet Factor 4 | +Inquiry |
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALCOCO1-7894HCL | Recombinant Human CALCOCO1 293 Cell Lysate | +Inquiry |
CCDC28A-7768HCL | Recombinant Human CCDC28A 293 Cell Lysate | +Inquiry |
NSMCE2-3685HCL | Recombinant Human NSMCE2 293 Cell Lysate | +Inquiry |
RAB40A-2594HCL | Recombinant Human RAB40A 293 Cell Lysate | +Inquiry |
SPIC-1516HCL | Recombinant Human SPIC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket