Recombinant Full Length Nasturtium Officinale Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL30963NF |
Product Overview : | Recombinant Full Length Nasturtium officinale Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A4QLV9) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nasturtium officinale (Water-cress) (Rorippa nasturtium-aquaticum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEVFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A4QLV9 |
◆ Recombinant Proteins | ||
SCO6013-1022S | Recombinant Streptomyces coelicolor A3(2) SCO6013 protein, His-tagged | +Inquiry |
RFL25461DF | Recombinant Full Length Danio Rerio N-Acetylaspartate Synthetase(Nat8L) Protein, His-Tagged | +Inquiry |
E2-735V | Recombinant HCV E2 Protein, His-tagged | +Inquiry |
GMPS-5024H | Recombinant Human GMPS Protein, GST-tagged | +Inquiry |
CALB1-10656H | Recombinant Human CALB1, His-tagged | +Inquiry |
◆ Native Proteins | ||
Tenascin-112H | Native Human Tenascin | +Inquiry |
KRT8-177B | Native bovine KRT8 | +Inquiry |
ARPC2-01P | Native Porcine ARPC2 Protein (Arp2/3 Protein Complex) | +Inquiry |
IBV-06I | Native Influenza B Antigen | +Inquiry |
ALP-151P | Active Native Porcine Kidney Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR72-337HCL | Recombinant Human WDR72 293 Cell Lysate | +Inquiry |
AWAT1-8556HCL | Recombinant Human AWAT1 293 Cell Lysate | +Inquiry |
AFAP1-8990HCL | Recombinant Human AFAP1 293 Cell Lysate | +Inquiry |
ACTA1-7HCL | Recombinant Human ACTA1 lysate | +Inquiry |
C3orf14-8054HCL | Recombinant Human C3orf14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket