Recombinant Full Length Human Reticulon-2(Rtn2) Protein, His-Tagged
Cat.No. : | RFL18444HF |
Product Overview : | Recombinant Full Length Human Reticulon-2(RTN2) Protein (O75298) (1-545aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-545) |
Form : | Lyophilized powder |
AA Sequence : | MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEETTSQDWGTPR ELTFSYIAFDGVVGSGGRRDSTARRPRPQGRSVSEPRDQHPQPSLGDSLESIPSLSQSPE PGRRGDPDTAPPSERPLEDLRLRLDHLGWVARGTGSGEDSSTSSSTPLEDEEPQEPNRLE TGEAGEELDLRLRLAQPSSPEVLTPQLSPGSGTPQAGTPSPSRSRDSNSGPEEPLLEEEE KQWGPLEREPVRGQCLDSTDQLEFTVEPRLLGTAMEWLKTSLLLAVYKTVPILELSPPLW TAIGWVQRGPTPPTPVLRVLLKWAKSPRSSGVPSLSLGADMGSKVADLLYWKDTRTSGVV FTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVHRGDGANPFQAYLDVD LTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTL LILGVIGLFTIPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGALASAAAAVSGS KAKAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RTN2 |
Synonyms | RTN2; NSPL1; Reticulon-2; Neuroendocrine-specific protein-like 1; NSP-like protein 1; Neuroendocrine-specific protein-like I; NSP-like protein I; NSPLI |
UniProt ID | O75298 |
◆ Recombinant Proteins | ||
SUPT4H1-4380R | Recombinant Rhesus Macaque SUPT4H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NTN1-2143H | Active Recombinant Human NTN1 protein, His-tagged | +Inquiry |
NAT2-3907R | Recombinant Rat NAT2 Protein | +Inquiry |
RFL1988MF | Recombinant Full Length Mouse Rhomboid Domain-Containing Protein 2(Rhbdd2) Protein, His-Tagged | +Inquiry |
GNPDA1-1912R | Recombinant Rhesus monkey GNPDA1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
MUC2-28P | Native Pig Mucin 2 (MUC2) Protein | +Inquiry |
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
Complement C1q-43H | Native Human Complement C1q | +Inquiry |
ApoB-3556H | Native Human ApoB | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1CA-2953HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
DES-6969HCL | Recombinant Human DES 293 Cell Lysate | +Inquiry |
URGCP-1891HCL | Recombinant Human URGCP cell lysate | +Inquiry |
Fetal-94M | Mouse Fetus Tissue Lysate (14 Day Fetus) | +Inquiry |
ECD-001HCL | Recombinant Human ECD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RTN2 Products
Required fields are marked with *
My Review for All RTN2 Products
Required fields are marked with *
0
Inquiry Basket