Recombinant Full Length Xenopus Laevis Reticulon-2(Rtn2) Protein, His-Tagged
Cat.No. : | RFL19209XF |
Product Overview : | Recombinant Full Length Xenopus laevis Reticulon-2(rtn2) Protein (Q4FZ76) (1-321aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-321) |
Form : | Lyophilized powder |
AA Sequence : | MGHVLSFTHCKDAPSTASSTPDSCPLEGEDDDTPVTEVDFWPLPSPHEPTFSYITIGSSA PLSRPPVRARRGLGQGRVHEAPREETEEKEVKDVVNYVLLENTCELKQISPLQVQEEVVF VAKPQPQVEVFRAVKDLLYWRDTLLSTGCLTGVTLSLLCLSQFSVISVFAYGCLIILSVT LTLRLYTKLLHALKRGNGANPFQYYLDTDLKLTTKQAEEIVARAFSLASTTLCTLRSLFL VEELKDSLKFLVIVYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHYVSLVSK KVNAFRSKFQGAAKKPPAKQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rtn2 |
Synonyms | rtn2; Reticulon-2; xRTN2 |
UniProt ID | Q4FZ76 |
◆ Recombinant Proteins | ||
Gc-3169M | Recombinant Mouse Gc Protein, Myc/DDK-tagged | +Inquiry |
GNG12A-12500Z | Recombinant Zebrafish GNG12A | +Inquiry |
MAPK1-101HFL | Unactive Recombinant Full Length Human MAPK1 Protein, N-GST-tagged | +Inquiry |
KRT15-3313R | Recombinant Rat KRT15 Protein | +Inquiry |
RFL15522AF | Recombinant Full Length Aggregatibacter Aphrophilus Upf0756 Membrane Protein Nt05Ha_0561 (Nt05Ha_0561) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FGA-80H | Active Native Human Fibrinogen (plasminogen depleted) | +Inquiry |
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
TF-31158TH | Native Human TF | +Inquiry |
Lectin-1785G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Adipose-630B | Bovine Adipose Tissue Lysate, Total Protein | +Inquiry |
FGFR4-2757MCL | Recombinant Mouse FGFR4 cell lysate | +Inquiry |
CHMP1B-7533HCL | Recombinant Human CHMP1B 293 Cell Lysate | +Inquiry |
TULP4-637HCL | Recombinant Human TULP4 293 Cell Lysate | +Inquiry |
TRIM43-774HCL | Recombinant Human TRIM43 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All rtn2 Products
Required fields are marked with *
My Review for All rtn2 Products
Required fields are marked with *
0
Inquiry Basket