Recombinant Full Length Mouse Reticulon-2(Rtn2) Protein, His-Tagged
Cat.No. : | RFL28512MF |
Product Overview : | Recombinant Full Length Mouse Reticulon-2(Rtn2) Protein (O70622) (1-471aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-471) |
Form : | Lyophilized powder |
AA Sequence : | MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEDEEEETTSQDWGTPR ELTFSYIAFDGVVGSGGRRDSVVRRPRPQGRSVSEPRDPPQQSGLGDSLESIPSLSQSPE PGRRGDPDPVPPAERPLEELRLRLDQLGWVVRSAGSGEDSATSSSTPLENEEPDGLEASE AGEETNLELRLAQSLHLQLEVLTPQLSPSSGTPQAHTPSPQRSQDSNSGPDDEPLLNVVE EHWRLLEQEPITAQCLDSTDQSEFMLEPLLLVADLLYWKDTRTSGAVFTGLMASLLCLLH FSIVSVAAHLALLGLCATISLRVYRKVLQAVHRGDGTNPFQAYLDMDLTLTREQTERLSQ QIASHVVSTATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTLVILGVVALFTVPL LYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGTLAPTASVSGSKAKAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rtn2 |
Synonyms | Rtn2; Nspl1; Reticulon-2; Neuroendocrine-specific protein-like 1; NSP-like protein 1; Neuroendocrine-specific protein-like I; NSP-like protein I; NSPLI |
UniProt ID | O70622 |
◆ Recombinant Proteins | ||
RFL-7530DF | Recombinant Full Length Dictyostelium Discoideum Chitobiosyldiphosphodolichol Beta-Mannosyltransferase(Alg1) Protein, His-Tagged | +Inquiry |
TEX12-16658M | Recombinant Mouse TEX12 Protein | +Inquiry |
PARK2-420H | Recombinant Human parkin RBR E3 ubiquitin protein ligase, His-tagged | +Inquiry |
AROF-1626B | Recombinant Bacillus subtilis AROF protein, His-tagged | +Inquiry |
CAPN2-6637C | Recombinant Chicken CAPN2 | +Inquiry |
◆ Native Proteins | ||
hypogaea 2S-156A | Native Arachis hypogaea 2S protein | +Inquiry |
ALB-8301S | Native Sheep ALB | +Inquiry |
GG-190H | Native Horse Gamma Globulin protein | +Inquiry |
Lectin-1745S | Active Native Sambucus Nigra Lectin Protein | +Inquiry |
EPX-1862H | Native Human Eosinophil Peroxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDND1-7456HCL | Recombinant Human CLDND1 293 Cell Lysate | +Inquiry |
UBXN1-541HCL | Recombinant Human UBXN1 293 Cell Lysate | +Inquiry |
LSG1-4614HCL | Recombinant Human LSG1 293 Cell Lysate | +Inquiry |
ANGPT2-2228HCL | Recombinant Human ANGPT2 cell lysate | +Inquiry |
NRL-3693HCL | Recombinant Human NRL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rtn2 Products
Required fields are marked with *
My Review for All Rtn2 Products
Required fields are marked with *
0
Inquiry Basket