Recombinant Full Length Bovine Parainfluenza 3 Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL2381BF |
Product Overview : | Recombinant Full Length Bovine parainfluenza 3 virus Hemagglutinin-neuraminidase(HN) Protein (P06167) (1-572aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine parainfluenza 3 virus (BPIV-3) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-572) |
Form : | Lyophilized powder |
AA Sequence : | MEYWKHTNSTKDTNNELGTTRDRHSSKATNIIMYIFWTTTSTILSVIFIMILINLIQENN HNKLMLQEIRKEFAAIDTKIQKTSDDIGTSIQSGINTRLLTIQSHVQNYIPLSLTQQMSD LRKFINDLTTKREHQEVPIQRMTHDSGIEPLNPDKFWRCTSGNPSLTSSPKIRLIPGPGL LATSTTVNGCIRLPSLAINNLIYAYTSNLITQGCQDIGKSYQVLQIGIITINSDLVPDLN PRVTHTFNIDDNRKSCSLALLNTDVYQLCSTPKVDERSDYASTGIEDIVLDIVTSNGLII TTRFTNNNITFDKPYAALYPSVGPGIYYKDKVIFLGYGGLEHEENGDVICNTTGCPGKTQ RDCNQASYSPWFSNRRMVNSIIVVDKGIDTTFSLRVWTIPMRQNYWGSEGRLLLLGDRIY IYTRSTSWHSKLQLGVIDISDFNNIRINWTWHNVLSRPGNDECPWGHSCPDGCITGVYTD AYPLNPSGSIVSSVILDSQKSRENPIITYSTATNRVNELAIYNRTLPAAYTTTNCITHYD KGYCFHIVEINHRSLNTFQPMLFKTEVPKNCS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P06167 |
◆ Recombinant Proteins | ||
Npnt-6167M | Recombinant Mouse Npnt Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNA2-6033C | Recombinant Chicken KCNA2 | +Inquiry |
OLC1-1452H | Recombinant Human OLC1, GST-tagged | +Inquiry |
RFL34815PF | Recombinant Full Length Pseudomonas Syringae Pv. Phaseolicola Upf0059 Membrane Protein Pspph_3559(Pspph_3559) Protein, His-Tagged | +Inquiry |
CGB3-3301HF | Recombinant Full Length Human CGB3 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
OX-LDL-985H | Native Human Lipoproteins, Oxidized LDL protein | +Inquiry |
MYH-11R | Active Native Rabbit Myosin II Protein | +Inquiry |
MMP9-29698TH | Native Human MMP9 | +Inquiry |
Lectin-1831R | Active Native Ricinus Communis Agglutinin I Protein, Biotinylated | +Inquiry |
Lectin-1819P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFF1-1127HCL | Recombinant Human TFF1 293 Cell Lysate | +Inquiry |
TBC1D19-1227HCL | Recombinant Human TBC1D19 293 Cell Lysate | +Inquiry |
TIPRL-1058HCL | Recombinant Human TIPRL 293 Cell Lysate | +Inquiry |
FGF7-6236HCL | Recombinant Human FGF7 293 Cell Lysate | +Inquiry |
FAM50A-6371HCL | Recombinant Human FAM50A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket