Recombinant Full Length Sendai Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL19496SF |
Product Overview : | Recombinant Full Length Sendai virus Hemagglutinin-neuraminidase(HN) Protein (P04853) (59-575aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sendai virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (59-575) |
Form : | Lyophilized powder |
AA Sequence : | SARQGYSMKEYSMTVEALNMSSREVKESLTSLIRQEVIARAVNIQSSVQTGIPVLLNKNS RDVIQMIDKSCSRQELTQHCESTIAVHHADGIAPLEPHSFWRCPVGEPYLSSDPEISLLP GPSLLSGSTTISGCVRLPSLSIGEAIYAYSSNLITQGCADIGKSYQVLQLGYISLNSDMF PDLNPVVSHTYDINDNRKSCSVVATGTRGYQLCSMPTVDERTDYSSDGIEDLVLDVLDLK GRTKSHRYRNSEVDLDHPFSALYPSVGNGIATEGSLIFLGYGGLTTPLQGDTKCRTQGCQ QVSQDTCNEALKITWLGGKQVVSVIIQVNDYLSERPKIRVTTIPITQNYLGAEGRLLKLG DRVYIYTRSSGWHSQLQIGVLDVSHPLTINWTPHEALSRPGNKECNWYNKCPKECISGVY TDAYPLSPDAANVATVTLYANTSRVNPTIMYSNTTNIINMLRIKDVQLEAAYTTTSCITH FGKGYCFHIIEINQKSLNTLQPMLFKTSIPKLCKAES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase; HN protein |
UniProt ID | P04853 |
◆ Recombinant Proteins | ||
RAP2B-30505TH | Recombinant Human RAP2B | +Inquiry |
Terf1-6358M | Recombinant Mouse Terf1 Protein, Myc/DDK-tagged | +Inquiry |
Anxa4-1340R | Recombinant Rat Anxa4 protein, His-tagged | +Inquiry |
IGHMBP2-4005Z | Recombinant Zebrafish IGHMBP2 | +Inquiry |
CDS1-977R | Recombinant Rat CDS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HPX-84R | Native Rat Hemopexin | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
FGB-59R | Native Rabbit Fibrinogen | +Inquiry |
C1q-01M | Native Monkey C1q Protein | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD37-7678HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
XG-264HCL | Recombinant Human XG 293 Cell Lysate | +Inquiry |
DDX31-7009HCL | Recombinant Human DDX31 293 Cell Lysate | +Inquiry |
BBX-159HCL | Recombinant Human BBX cell lysate | +Inquiry |
IFNW1-2929HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket