Recombinant Full Length Human NT5C Protein, C-Flag-tagged
Cat.No. : | NT5C-2153HFL |
Product Overview : | Recombinant Full Length Human NT5C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5' deoxyribonucleotides (dNTP) and 2'(3')-dNTP and ribonucleotides, but not 5' ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in its preference for 5'-dNTP. It may be one of the enzymes involved in regulating the size of dNTP pools in cells. Alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.2 kDa |
AA Sequence : | MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGF FLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGD LLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Protein Pathways : | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | NT5C 5', 3'-nucleotidase, cytosolic [ Homo sapiens (human) ] |
Official Symbol | NT5C |
Synonyms | DNT; cdN; DNT1; P5N2; PN-I; HEL74; PN-II; UMPH2; dNT-1 |
Gene ID | 30833 |
mRNA Refseq | NM_014595.3 |
Protein Refseq | NP_055410.1 |
MIM | 191720 |
UniProt ID | Q8TCD5 |
◆ Recombinant Proteins | ||
Nt5c-1865M | Recombinant Mouse Nt5c Protein, His-tagged | +Inquiry |
NT5C-6577H | Recombinant Human NT5C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NT5C-4633H | Recombinant Human NT5C protein, His&Myc-tagged | +Inquiry |
NT5C-2153HFL | Recombinant Full Length Human NT5C Protein, C-Flag-tagged | +Inquiry |
NT5C-1554H | Recombinant Human NT5C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NT5C-1225HCL | Recombinant Human NT5C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NT5C Products
Required fields are marked with *
My Review for All NT5C Products
Required fields are marked with *
0
Inquiry Basket