Recombinant Human NT5C protein, His&Myc-tagged
Cat.No. : | NT5C-4633H |
Product Overview : | Recombinant Human NT5C protein(Q8TCD5)(1-201aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-201a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE |
Gene Name | NT5C 5, 3-nucleotidase, cytosolic [ Homo sapiens ] |
Official Symbol | NT5C |
Synonyms | NT5C; 5, 3-nucleotidase, cytosolic; 5 nucleotidase, deoxy (pyrimidine), cytosolic type C , UMPH2, uridine 5 prime monophosphate hydrolase 2; 5(3)-deoxyribonucleotidase, cytosolic type; cdN; DNT 1; dNT 1; DNT1; PN I; deoxy-5-nucleotidase 1; cytosolic 5,3-pyrimidine nucleotidase; uridine 5-prime monophosphate hydrolase 2; uridine 5-monophosphate phosphohydrolase 2; 5 nucleotidase, deoxy (pyrimidine), cytosolic type C; DNT; P5N2; PN-I; PN-II; UMPH2; dNT-1; |
Gene ID | 30833 |
mRNA Refseq | NM_001252377 |
Protein Refseq | NP_001239306 |
MIM | 191720 |
UniProt ID | Q8TCD5 |
◆ Recombinant Proteins | ||
NT5C-3533H | Recombinant Human NT5C protein, His-tagged | +Inquiry |
Nt5c-1865M | Recombinant Mouse Nt5c Protein, His-tagged | +Inquiry |
NT5C-1380H | Recombinant Human NT5C, GST-tagged | +Inquiry |
NT5C-2153HFL | Recombinant Full Length Human NT5C Protein, C-Flag-tagged | +Inquiry |
Nt5c-4513M | Recombinant Mouse Nt5c Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NT5C-1225HCL | Recombinant Human NT5C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NT5C Products
Required fields are marked with *
My Review for All NT5C Products
Required fields are marked with *
0
Inquiry Basket