Recombinant Human NT5C protein, His&Myc-tagged

• Cat.No.: NT5C-4633H
• Product Overview: Recombinant Human NT5C protein(Q8TCD5)(1-201aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-201a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.4 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE

Gene Information

• Gene Name: NT5C 5, 3-nucleotidase, cytosolic [ Homo sapiens ]
• Official Symbol: NT5C
• Synonyms: NT5C; 5, 3-nucleotidase, cytosolic; 5 nucleotidase, deoxy (pyrimidine), cytosolic type C , UMPH2, uridine 5 prime monophosphate hydrolase 2; 5(3)-deoxyribonucleotidase, cytosolic type; cdN; DNT 1; dNT 1; DNT1; PN I; deoxy-5-nucleotidase 1; cytosolic 5,3-pyrimidine nucleotidase; uridine 5-prime monophosphate hydrolase 2; uridine 5-monophosphate phosphohydrolase 2; 5 nucleotidase, deoxy (pyrimidine), cytosolic type C; DNT; P5N2; PN-I; PN-II; UMPH2; dNT-1
• Gene ID: 30833
• mRNA Refseq: NM_001252377
• Protein Refseq: NP_001239306
• MIM: 191720
• UniProt ID: Q8TCD5