Recombinant Human MDH1 protein, GST-tagged
Cat.No. : | MDH1-301623H |
Product Overview : | Recombinant Human MDH1 (1-334 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Ala334 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MDH1 malate dehydrogenase 1, NAD (soluble) [ Homo sapiens ] |
Official Symbol | MDH1 |
Synonyms | MDH1; malate dehydrogenase 1, NAD (soluble); malate dehydrogenase, cytoplasmic; soluble malate dehydrogenase; cytosolic malate dehydrogenase; MDHA; MOR2; MDH-s; MGC:1375; |
Gene ID | 4190 |
mRNA Refseq | NM_001199111 |
Protein Refseq | NP_001186040 |
MIM | 154200 |
UniProt ID | P40925 |
◆ Recombinant Proteins | ||
MDH1-301623H | Recombinant Human MDH1 protein, GST-tagged | +Inquiry |
Mdh1-2528R | Recombinant Rat Mdh1 protein, His-tagged | +Inquiry |
MDH1-4522H | Recombinant Human MDH1 Protein (Ser2-Ala334), C-His tagged | +Inquiry |
MDH1-1546H | Recombinant Human MDH1 protein, His & GST-tagged | +Inquiry |
MDH1-1384H | Recombinant Human MDH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDH1-4409HCL | Recombinant Human MDH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MDH1 Products
Required fields are marked with *
My Review for All MDH1 Products
Required fields are marked with *
0
Inquiry Basket