Recombinant Full Length Human HSBP1 Protein, GST-tagged

Cat.No. : HSBP1-3704HF
Product Overview : Human HSBP1 full-length ORF ( AAH07515, 1 a.a. - 76 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 76 amino acids
Description : The heat-shock response is elicited by exposure of cells to thermal and chemical stress and through the activation of HSFs (heat shock factors) results in the elevated expression of heat-shock induced genes. Heat shock factor binding protein 1 (HSBP1), is a 76-amino-acid protein that binds to heat shock factor 1(HSF1), which is a transcription factor involved in the HS response. During HS response, HSF1 undergoes conformational transition from an inert non-DNA-binding monomer to active functional trimers. HSBP1 is nuclear-localized and interacts with the active trimeric state of HSF1 to negatively regulate HSF1 DNA-binding activity. Overexpression of HSBP1 in mammalian cells represses the transactivation activity of HSF1. When overexpressed in C.elegans HSBP1 has severe effects on survival of the animals after thermal and chemical stress consistent with a role of HSBP1 as a negative regulator of heat shock response. [provided by RefSeq
Molecular Mass : 34.1 kDa
AA Sequence : MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSBP1 heat shock factor binding protein 1 [ Homo sapiens ]
Official Symbol HSBP1
Synonyms HSBP1; heat shock factor binding protein 1; heat shock factor-binding protein 1; nasopharyngeal carcinoma-associated antigen 13; NPC-A-13; DKFZp686D1664; DKFZp686O24200;
Gene ID 3281
mRNA Refseq NM_001537
Protein Refseq NP_001528
MIM 604553
UniProt ID O75506

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HSBP1 Products

Required fields are marked with *

My Review for All HSBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon