Recombinant Full Length Human HMGB1 Protein, GST-tagged
Cat.No. : | HMGB1-3643HF |
Product Overview : | Human HMGB1 full-length ORF ( AAH03378.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 215 amino acids |
Description : | This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015] |
Molecular Mass : | 49.39 kDa |
AA Sequence : | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HMGB1 high mobility group box 1 [ Homo sapiens ] |
Official Symbol | HMGB1 |
Synonyms | HMGB1; high mobility group box 1; high mobility group (nonhistone chromosomal) protein 1 , high mobility group box 1 , HMG1; high mobility group protein B1; Amphoterin; DKFZp686A04236; high mobility group protein 1; HMG3; SBP 1; Sulfoglucuronyl carbohydrate binding protein; HMG-1; high-mobility group box 1; high-mobility group (nonhistone chromosomal) protein 1; HMG1; SBP-1; |
Gene ID | 3146 |
mRNA Refseq | NM_002128 |
Protein Refseq | NP_002119 |
MIM | 163905 |
UniProt ID | P09429 |
◆ Recombinant Proteins | ||
HMGB1-291H | Recombinant Human HMGB1 Protein, His-tagged | +Inquiry |
Hmgb1-593R | Recombinant Rat Hmgb1 Protein, His-tagged | +Inquiry |
Hmgb1-293R | Recombinant Rat Hmgb1, Fc-tagged | +Inquiry |
Hmgb1-6948M | Active Recombinant Mouse Hmgb1 protein(Met1-Glu215), hFc-tagged | +Inquiry |
HMGB1-116H | Recombinant Active Human HMGB1 Protein, His-tagged(C-ter) | +Inquiry |
◆ Native Proteins | ||
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB1-1677MCL | Recombinant Mouse HMGB1 cell lysate | +Inquiry |
HMGB1-2076HCL | Recombinant Human HMGB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGB1 Products
Required fields are marked with *
My Review for All HMGB1 Products
Required fields are marked with *
0
Inquiry Basket