Recombinant Human HMGB1 Protein, His-tagged
Cat.No. : | HMGB1-291H |
Product Overview : | Recombinant human HMGB1 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 215 |
Description : | This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. |
Form : | Lyophilized |
Molecular Mass : | 25.7 kDa |
AA Sequence : | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | HMGB1 high mobility group box 1 [ Homo sapiens (human) ] |
Official Symbol | HMGB1 |
Synonyms | HMGB1; high mobility group box 1; high mobility group (nonhistone chromosomal) protein 1 , high mobility group box 1 , HMG1; high mobility group protein B1; Amphoterin; DKFZp686A04236; high mobility group protein 1; HMG3; SBP 1; Sulfoglucuronyl carbohydrate binding protein; HMG-1; high-mobility group box 1; high-mobility group (nonhistone chromosomal) protein 1; HMG1; SBP-1; |
Gene ID | 3146 |
mRNA Refseq | NM_002128 |
Protein Refseq | NP_002119 |
MIM | 163905 |
UniProt ID | P09429 |
◆ Recombinant Proteins | ||
HMGB1-2613H | Recombinant Human HMGB1 protein(81-200 aa), C-His-tagged | +Inquiry |
HMGB1-2108R | Recombinant Rhesus monkey HMGB1 Protein, His-tagged | +Inquiry |
Hmgb1-293R | Recombinant Rat Hmgb1, Fc-tagged | +Inquiry |
HMGB1-146H | Active Recombinant Human HMGB1 Protein (Met1-Asp169), N-His-SUMO tagged, Animal-free, Carrier-free | +Inquiry |
HMGB1-4866H | Recombinant Human HMGB1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB1-1677MCL | Recombinant Mouse HMGB1 cell lysate | +Inquiry |
HMGB1-2076HCL | Recombinant Human HMGB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGB1 Products
Required fields are marked with *
My Review for All HMGB1 Products
Required fields are marked with *
0
Inquiry Basket