Recombinant Full Length Human GM2A Protein, C-Flag-tagged
Cat.No. : | GM2A-1665HFL |
Product Overview : | Recombinant Full Length Human GM2A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.7 kDa |
AA Sequence : | MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIVVPGNVTLSVVG STSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPF KEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Lysosome |
Full Length : | Full L. |
Gene Name | GM2A ganglioside GM2 activator [ Homo sapiens (human) ] |
Official Symbol | GM2A |
Synonyms | GM2AP; SAP-3; GM2-AP |
Gene ID | 2760 |
mRNA Refseq | NM_000405.5 |
Protein Refseq | NP_000396.2 |
MIM | 613109 |
UniProt ID | P17900 |
◆ Recombinant Proteins | ||
GM2A-2400H | Recombinant Human GM2A Protein (Ser32-Ile193), C-His tagged | +Inquiry |
GM2A-1665HFL | Recombinant Full Length Human GM2A Protein, C-Flag-tagged | +Inquiry |
GM2A-5001H | Recombinant Human GM2A Protein, GST-tagged | +Inquiry |
GM2A-199HF | Recombinant Full Length Human GM2A Protein | +Inquiry |
GM2A-521H | Recombinant Human GM2A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GM2A-450HCL | Recombinant Human GM2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GM2A Products
Required fields are marked with *
My Review for All GM2A Products
Required fields are marked with *
0
Inquiry Basket