Recombinant Human GM2A protein, His-SUMO-tagged
Cat.No. : | GM2A-2972H |
Product Overview : | Recombinant Human GM2A protein(P17900)(32-193aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 32-193aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.6 |
AA Sequence : | SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GM2A GM2 ganglioside activator [ Homo sapiens ] |
Official Symbol | GM2A |
Synonyms | GM2A; GM2 ganglioside activator; GM2 ganglioside activator protein; ganglioside GM2 activator; cerebroside sulfate activator protein; SAP 3; sphingolipid activator protein 3; shingolipid activator protein 3; SAP-3; GM2-AP; |
Gene ID | 2760 |
mRNA Refseq | NM_000405 |
Protein Refseq | NP_000396 |
MIM | 613109 |
UniProt ID | P17900 |
◆ Recombinant Proteins | ||
GM2A-299C | Recombinant Cynomolgus Monkey GM2A Protein, His (Fc)-Avi-tagged | +Inquiry |
GM2A-554C | Recombinant Cynomolgus GM2A Protein, His-tagged | +Inquiry |
GM2A-5366HF | Recombinant Full Length Human GM2A Protein, GST-tagged | +Inquiry |
GM2A-1665HFL | Recombinant Full Length Human GM2A Protein, C-Flag-tagged | +Inquiry |
GM2A-2973H | Recombinant Human GM2A protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GM2A-450HCL | Recombinant Human GM2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GM2A Products
Required fields are marked with *
My Review for All GM2A Products
Required fields are marked with *
0
Inquiry Basket