Recombinant Full Length Human Glycerophosphodiester Phosphodiesterase Domain-Containing Protein 5(Gdpd5) Protein, His-Tagged
Cat.No. : | RFL23869HF |
Product Overview : | Recombinant Full Length Human Glycerophosphodiester phosphodiesterase domain-containing protein 5(GDPD5) Protein (Q8WTR4) (1-605aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-605) |
Form : | Lyophilized powder |
AA Sequence : | MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTFTFGLTLTWLY FWWEVHNDYDEFNWYLYNRMGYWSDWPVPILVTTAAAFAYIAGLLVLALCHIAVGQQMNL HWLHKIGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHVGAVAAVTMLSWIVA GQFARAERTSSQVTILCTFFTVVFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLA PEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTLRRTTNVEEEFPELARRPASML NWTTLQRLNAGQWFLKTDPFWTASSLSPSDHREAQNQSICSLAELLELAKGNATLLLNLR DPPREHPYRSSFINVTLEAVLHSGFPQHQVMWLPSRQRPLVRKVAPGFQQTSGSKEAVAS LRRGHIQRLNLRYTQVSRQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHA LSQVPSPLWIMPPDEYCLMWVTADLVSFTLIVGIFVLQKWRLGGIRSYNPEQIMLSAAVR RTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSHTKTLI ERSGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GDPD5 |
Synonyms | GDPD5; GDE2; PP6037; PP9363; UNQ1850/PRO3580; Glycerophosphodiester phosphodiesterase domain-containing protein 5; Glycerophosphocholine phosphodiesterase GDPD5; Glycerophosphodiester phosphodiesterase 2; Phosphoinositide phospholipase C GDPD5 |
UniProt ID | Q8WTR4 |
◆ Recombinant Proteins | ||
SLC27A4-2737H | Recombinant Human SLC27A4, GST-tagged | +Inquiry |
PPY-30779TH | Recombinant Human PPY | +Inquiry |
ODF3B-3716H | Recombinant Human ODF3B Protein, His (Fc)-Avi-tagged | +Inquiry |
GRB10-3345C | Recombinant Chicken GRB10 | +Inquiry |
TIMP2-5141H | Recombinant Human TIMP Metallopeptidase Inhibitor 2 | +Inquiry |
◆ Native Proteins | ||
FLNA-170C | Active Native chicken FLNA | +Inquiry |
Immunoglobulin G4-84H | Native Human Immunoglobulin G4 | +Inquiry |
B. afzelii-21 | Native Borrelia afzelii Antigen | +Inquiry |
Collagen Type I-61H | Native Human Collagen Type I/III | +Inquiry |
A2M-01H | Native Human A2M Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PARP8-1285HCL | Recombinant Human PARP8 cell lysate | +Inquiry |
PGRMC2-3247HCL | Recombinant Human PGRMC2 293 Cell Lysate | +Inquiry |
BLOC1S2-8443HCL | Recombinant Human BLOC1S2 293 Cell Lysate | +Inquiry |
ASIC1-9101HCL | Recombinant Human ACCN2 293 Cell Lysate | +Inquiry |
Ovary-669H | Hamster Ovary Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GDPD5 Products
Required fields are marked with *
My Review for All GDPD5 Products
Required fields are marked with *
0
Inquiry Basket