Recombinant Full Length Chicken Glycerophosphodiester Phosphodiesterase Domain-Containing Protein 5(Gdpd5) Protein, His-Tagged
Cat.No. : | RFL11391GF |
Product Overview : | Recombinant Full Length Chicken Glycerophosphodiester phosphodiesterase domain-containing protein 5(GDPD5) Protein (Q3KTM2) (1-599aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-599) |
Form : | Lyophilized powder |
AA Sequence : | MVKHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTKWERLWFLILTSSFFLTLVWFY FWWEVHNDYNEINWFLYNRMGYWSDWSIPILVTTAAGFTYITVLLILALCHIAVGQQMNL HWLHKIGLMTTLITTVVTMSSIAQLWDDEWEMVFISLQATAPFLHIGALAAVTALSWLIA GQFARMEKATSQMLMVTAYLAVVVALYLVPLTISSPCIMEKKALGPKPAIIGHRGAPMLA PENTLMSFQKAVEQKIYGVQADVILSYDGVPFLMHDKTLRRTTNVEEVFPGRAYEHSSMF NWTDLEMLNAGEWFLRNDPFWTAGSLSRSDYLEAANQSVCKLADMLEVIKDNTSLILNFQ DLPPDHPYYTSYINITLKTILASGIQQQAVMWLPDTERQLVRQIAPAFQQTSGLKLDAER LREKGIVKLNLRYTKVTNEDVRDYMAANLSVNLYTVNEPWLYSILWCTGVPSVTSDSSHV LRKVPFPIWLMPPDEYRLIWITSDLISFIIIVGVFIFQNYHNDQWRLGSIRTYNPEQIML SAAVRRSSRDVKIMKEKLIFSEINNGVETTDELSLCSENGYANEMVTPTDHRDTRLRMN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GDPD5 |
Synonyms | GDPD5; GDE2; Glycerophosphodiester phosphodiesterase domain-containing protein 5; Glycerophosphocholine phosphodiesterase GDPD5; Glycerophosphodiester phosphodiesterase 2; Phosphoinositide phospholipase C GDPD5 |
UniProt ID | Q3KTM2 |
◆ Native Proteins | ||
Lectin-1802L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 488 Labeled | +Inquiry |
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
TOD-43 | Active Native Tyramine Oxidase | +Inquiry |
CGB-1856H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
C1q-01M | Native Monkey C1q Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS8-2368HCL | Recombinant Human RGS8 293 Cell Lysate | +Inquiry |
ADAM12-2592HCL | Recombinant Human ADAM12 cell lysate | +Inquiry |
OR8B8-1258HCL | Recombinant Human OR8B8 cell lysate | +Inquiry |
CD207-7680HCL | Recombinant Human CD207 293 Cell Lysate | +Inquiry |
LRSAM1-1036HCL | Recombinant Human LRSAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDPD5 Products
Required fields are marked with *
My Review for All GDPD5 Products
Required fields are marked with *
0
Inquiry Basket