Recombinant Full Length Mouse Glycerophosphodiester Phosphodiesterase Domain-Containing Protein 5(Gdpd5) Protein, His-Tagged
Cat.No. : | RFL28699MF |
Product Overview : | Recombinant Full Length Mouse Glycerophosphodiester phosphodiesterase domain-containing protein 5(Gdpd5) Protein (Q640M6) (1-607aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-607) |
Form : | Lyophilized powder |
AA Sequence : | MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLVCTFSLTLTWLY FWWGVHNDYDEFNWYLYNRMGYWSDWSVPILVTSAAAFTYIAGLLVLALCHIAVGQQLNL HWIHKMGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHIGALVAITALSWIVA GQFARAERSSSQLTILCTFFAVVFTFYLIPLTISSPCIMEKKDLGPKPALIGHRGAPMLA PEHTVMSFRKALEQRLYGLQADITISLDGVPFLMHDTTLRRTTNVEHLFPELARRPAAML NWTVLQRLNAGQWFLKTDPFWTASSLSPSDHREVQNQSICSLAELLELAKGNASLLLNLR DPPRDHPYRGSFLNVTLEAVLRSGFPQHQVMWLFNRQRPLVRKMAPGFQQTSGSKEAIAN LRKGHIQKLNLRYTQVSHQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHT LSRVPSPLWIMPPDEYCLMWVTADLISFSLIIGIFVLQKWRLGGIRSYNPEQIMLSAAVR RTSRDVSIMKEKLIFSEISDGVEVSDELSVCSDSSYDTYANANSTATPVGPRNAGSRAKT VTEQSGH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gdpd5 |
Synonyms | Gdpd5; Gde2; Glycerophosphodiester phosphodiesterase domain-containing protein 5; Glycerophosphocholine phosphodiesterase GDPD5; Glycerophosphodiester phosphodiesterase 2; Phosphoinositide phospholipase C GDPD5 |
UniProt ID | Q640M6 |
◆ Recombinant Proteins | ||
UBE2N-2038C | Recombinant Chicken UBE2N | +Inquiry |
TEK-996R | Recombinant Rhesus TEK Protein (Met1-Lys745), His-tagged | +Inquiry |
ALDH9A1-3945H | Recombinant Human ALDH9A1 protein, His-tagged | +Inquiry |
A4GNT-16H | Recombinant Human A4GNT, His-tagged | +Inquiry |
CASP3-110C | Recombinant Cynomolgus Monkey CASP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
SERPINF2-5338H | Active Native Human SERPINF2 Protein | +Inquiry |
Collagen-48H | Native Human Collagen V | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR3-7694HCL | Recombinant Human CCR3 293 Cell Lysate | +Inquiry |
MMP1-2884HCL | Recombinant Human MMP1 cell lysate | +Inquiry |
TWIST1-1865HCL | Recombinant Human TWIST1 cell lysate | +Inquiry |
TUBGCP4-1862HCL | Recombinant Human TUBGCP4 cell lysate | +Inquiry |
TMED9-1021HCL | Recombinant Human TMED9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gdpd5 Products
Required fields are marked with *
My Review for All Gdpd5 Products
Required fields are marked with *
0
Inquiry Basket