Recombinant Human ESM1 Protein (20-184aa), C-His tagged
Cat.No. : | ESM1-04H |
Product Overview : | Recombinant human ESM1 (20-184aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 20-184aa |
Description : | This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 19.2 kDa (174aa) |
AA Sequence : | ADLWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPRHHHHHH |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ] |
Official Symbol | ESM1 |
Synonyms | ESM1; endothelial cell-specific molecule 1; ESM-1; endocan; |
Gene ID | 11082 |
mRNA Refseq | NM_007036 |
Protein Refseq | NP_008967 |
MIM | 601521 |
UniProt ID | Q9NQ30 |
◆ Recombinant Proteins | ||
Esm1-7412M | Recombinant Mouse Esm1 Protein, His-tagged | +Inquiry |
Esm1-8703M | Recombinant Mouse ESM1 protein(Met1-Arg184), His-tagged | +Inquiry |
ESM1-2759H | Recombinant Human ESM1 Protein (Trp20-Arg184), C-His tagged | +Inquiry |
Esm1-2871M | Recombinant Mouse Esm1 protein, His-SUMO-tagged | +Inquiry |
ESM1-456H | Recombinant Human ESM1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESM1-001MCL | Recombinant Mouse ESM1 cell lysate | +Inquiry |
ESM1-001HCL | Recombinant Human ESM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESM1 Products
Required fields are marked with *
My Review for All ESM1 Products
Required fields are marked with *
0
Inquiry Basket