Recombinant Full Length Human DOCK1 Protein

• Cat.No.: DOCK1-126HF
• Product Overview: Recombinant full length Human DOCK1 with N-terminal proprietary tag, 42.79 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 152 amino acids
• Description: This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis.
• Form: Liquid
• Molecular Mass: 42.790kDa inclusive of tags
• AA Sequence: MRIGRQSCKIHNYAINNGLFFKCMISPPSGDVRNDIYVTL VQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGD EAISEYKSVIYYQVKQPRWFETVKVLFTWSFYHMALIMKC SFVTQGNILTSSSARELLQAGRVSPNKVIQGC
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ]
• Official Symbol: DOCK1
• Synonyms: DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK
• Gene ID: 1793
• mRNA Refseq: NM_001380
• Protein Refseq: NP_001371
• MIM: 601403
• UniProt ID: Q14185