Recombinant Human DOCK1

• Cat.No.: DOCK1-26951TH
• Product Overview: Recombinant fragment of Human DOCK1 (aa 698-803) with N-terminal proprietary tag, 37.29 kDa.

Specification

• Description: This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis.
• Protein length: 106 amino acids
• Molecular Weight: 37.290kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Highly expressed in placenta, lung, kidney, pancreas and ovary. Expressed at intermediate level in thymus, testes and colon.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYK AMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFR SINDMMSSMSDQTVRVKGAALKYLPT
• Sequence Similarities: Belongs to the DOCK family.Contains 1 DHR-1 (CZH-1) domain.Contains 1 DHR-2 (CZH-2) domain.Contains 1 SH3 domain.
• Tag: Non

Gene Information

• Gene Name: DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ]
• Official Symbol: DOCK1
• Synonyms: DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK
• Gene ID: 1793
• mRNA Refseq: NM_001380
• Protein Refseq: NP_001371
• MIM: 601403
• Uniprot ID: Q14185
• Chromosome Location: 10q26.13-q26.3
• Pathway: Axon guidance, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; DCC mediated attractive signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem
• Function: GTP binding; GTPase activator activity; GTPase binding; SH3 domain binding; guanyl-nucleotide exchange factor activity