Recombinant Full Length Human DEFB4A Protein, GST-tagged

Cat.No. : DEFB4A-3752HF
Product Overview : Human DEFB4 full-length ORF ( NP_004933.1, 1 a.a. - 64 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 64 amino acids
Description : Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Jul 2008]
Molecular Mass : 33.4 kDa
AA Sequence : MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEFB4A defensin beta 4A [ Homo sapiens (human) ]
Official Symbol DEFB4A
Synonyms DEFB4; DEFB4A; defensin beta 4A; BD-2; SAP1; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102; beta-defensin 4A; beta defensin-2; defensin, beta 2; defensin, beta 4; skin-antimicrobial peptide 1
Gene ID 1673
mRNA Refseq NM_004942
Protein Refseq NP_004933
MIM 602215
UniProt ID O15263

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEFB4A Products

Required fields are marked with *

My Review for All DEFB4A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon