Recombinant Human DEFB4A protein, GST-tagged

• Cat.No.: DEFB4A-2815H
• Product Overview: Recombinant Human DEFB4A protein(O15263)(1-64aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-64aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.3 kDa
• AA Sequence: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC CKKP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: DEFB4A defensin, beta 4A [ Homo sapiens ]
• Official Symbol: DEFB4A
• Synonyms: DEFB4A; defensin, beta 4A; DEFB2, DEFB4, DEFB102, defensin, beta 2 , defensin, beta 4; beta-defensin 4A; DEFB 2; HBD 2; SAP1; defensin, beta 2; defensin, beta 4; skin-antimicrobial peptide 1; BD-2; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102
• Gene ID: 1673
• mRNA Refseq: NM_004942
• Protein Refseq: NP_004933
• MIM: 602215
• UniProt ID: O15263