Recombinant Human DEFB4A Protein, GST-tagged

• Cat.No.: DEFB4A-5133H
• Product Overview: Human DEFB4 full-length ORF ( NP_004933.1, 1 a.a. - 64 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Jul 2008]
• Molecular Mass: 33.4 kDa
• AA Sequence: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEFB4A defensin beta 4A [ Homo sapiens (human) ]
• Official Symbol: DEFB4A
• Synonyms: DEFB4; DEFB4A; defensin beta 4A; BD-2; SAP1; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102; beta-defensin 4A; beta defensin-2; defensin, beta 2; defensin, beta 4; skin-antimicrobial peptide 1
• Gene ID: 1673
• mRNA Refseq: NM_004942
• Protein Refseq: NP_004933
• MIM: 602215
• UniProt ID: O15263