Recombinant Full Length Human DEFA6 Protein, GST-tagged

• Cat.No.: DEFA6-2429HF
• Product Overview: Human DEFA6 full-length ORF ( NP_001917.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. [provided by RefSeq, Oct 2014]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 37.4 kDa
• Protein length: 100 amino acids
• AA Sequence: MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEFA6 defensin, alpha 6, Paneth cell-specific [ Homo sapiens ]
• Official Symbol: DEFA6
• Synonyms: DEFA6; defensin, alpha 6, Paneth cell-specific; defensin-6; DEF6; HD 6; defensin 6; HD-6
• Gene ID: 1671
• mRNA Refseq: NM_001926
• Protein Refseq: NP_001917
• MIM: 600471
• UniProt ID: Q01524