Recombinant Full Length Human DEFA6 Protein, GST-tagged

Cat.No. : DEFA6-2429HF
Product Overview : Human DEFA6 full-length ORF ( NP_001917.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. [provided by RefSeq, Oct 2014]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 37.4 kDa
Protein length : 100 amino acids
AA Sequence : MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEFA6 defensin, alpha 6, Paneth cell-specific [ Homo sapiens ]
Official Symbol DEFA6
Synonyms DEFA6; defensin, alpha 6, Paneth cell-specific; defensin-6; DEF6; HD 6; defensin 6; HD-6;
Gene ID 1671
mRNA Refseq NM_001926
Protein Refseq NP_001917
MIM 600471
UniProt ID Q01524

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEFA6 Products

Required fields are marked with *

My Review for All DEFA6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon