Recombinant Human DEFA6

Description :	Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel.
Protein length :	100 amino acids
Molecular Weight :	37.070kDa inclusive of tags
Source :	Wheat germ
Tissue specificity :	Paneth cells of the small intestine.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
Sequence Similarities :	Belongs to the alpha-defensin family.
Tag :	Non

Gene Name	DEFA6 defensin, alpha 6, Paneth cell-specific [ Homo sapiens ]
Official Symbol	DEFA6
Synonyms	DEFA6; defensin, alpha 6, Paneth cell-specific; defensin-6; DEF6; HD 6;
Gene ID	1671
mRNA Refseq	NM_001926
Protein Refseq	NP_001917
MIM	600471
Uniprot ID	Q01524
Chromosome Location	8p23.1