Recombinant Full Length Human Coronavirus Hku1 Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL20784HF |
Product Overview : | Recombinant Full Length Human coronavirus HKU1 Hemagglutinin-esterase(HE) Protein (Q0ZME8) (14-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HCoV-HKU1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (14-385) |
Form : | Lyophilized powder |
AA Sequence : | FNEPLNVVSHLNHDWFLFGDSRSDCNHINNLKIKNYGYLDIHPSLCNNGKISSSAGDSIF KSYHFTRFYNYTGEGDQIIFYEGVNFSPHHRFKCFFNGSNDVWIFNKVRFYRALYSNMAL FRYLTFVDILYNFSFSIKANICNSNILSLNNPIFISTNYSKDVYFTLSGCSLYLVPLCLF KSNFSQYYYNMDTGFAYGYSNFVSSDLDCTYISLKSGSYKIFSTGFVLSIPTKALCFNKS KQFVPVQVVDSRWNNLRASDTSLSDACQLPYCYFRNSSGNYVGKYDINHGDNGFTSILSG LLYNVSCISYYGSFLYDNFTSIWPRFSFGNCPTSAYIKLNCFYDPLPIILQGILLFLALL FIVFLLFLVYHG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | Q0ZME8 |
◆ Native Proteins | ||
BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
H3N20799-215I | Native H3N2 (A/Panama/2007/99) H3N20799 protein | +Inquiry |
R-PE-004R | Native Red Fluorescent Protein | +Inquiry |
GPDH-119R | Active Native Rabbit Glycerol-3-phosphate Dehydrogenase | +Inquiry |
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHA2-2138MCL | Recombinant Mouse EPHA2 cell lysate | +Inquiry |
Rectum-54H | Human Rectum Tumor Tissue Lysate | +Inquiry |
LZTS1-4574HCL | Recombinant Human LZTS1 293 Cell Lysate | +Inquiry |
POLR1E-3038HCL | Recombinant Human POLR1E 293 Cell Lysate | +Inquiry |
CDK5RAP1-7624HCL | Recombinant Human CDK5RAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket