Recombinant Full Length Bovine Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL29409BF |
Product Overview : | Recombinant Full Length Bovine coronavirus Hemagglutinin-esterase(HE) Protein (P59710) (19-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-424) |
Form : | Lyophilized powder |
AA Sequence : | FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVNTNPRNYSYMDLNPALCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGLNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYSYGRCPTAADIN TPDVPICVYDPLPLILLGILLGVAVIIIVVLLLYFMVDNGTRLHDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | P59710 |
◆ Recombinant Proteins | ||
GLT8D2-5354HF | Recombinant Full Length Human GLT8D2 Protein, GST-tagged | +Inquiry |
IGF1-4121H | Recombinant Human IGF1 protein, GST-tagged | +Inquiry |
C9H10orf54-1234RF | Recombinant Monkey C9H10orf54 Protein, His-tagged, FITC conjugated | +Inquiry |
IL13-3589H | Recombinant Human IL13 protein, His-tagged | +Inquiry |
RFL36507BF | Recombinant Full Length Bacillus Subtilis Protein Ccdc(Ccdc) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1736C | Active Native Canavalia ensiformis Concanavalin A Protein, Rhodamine labeled | +Inquiry |
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
SERPINA1-P035H | Native Human alpha-1 proteinase inhibitor therapeutic protein (Aralast, Aralast NP, Glassia, Prolastin, Prolastin-C, Zemaira) | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
Ighg2b-162M | Native Mouse Immunoglobulin G2b | +Inquiry |
◆ Cell & Tissue Lysates | ||
CORO1C-7343HCL | Recombinant Human CORO1C 293 Cell Lysate | +Inquiry |
H293-01HL | Human 293, Transformed Primary Embryonal Kidney lysate | +Inquiry |
PPP1R3B-2935HCL | Recombinant Human PPP1R3B 293 Cell Lysate | +Inquiry |
LSM5-9172HCL | Recombinant Human LSM5 293 Cell Lysate | +Inquiry |
SUV420H2-1331HCL | Recombinant Human SUV420H2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket