Recombinant Full Length Bovine Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL15919BF |
Product Overview : | Recombinant Full Length Bovine coronavirus Hemagglutinin-esterase(HE) Protein (P33468) (19-421aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-421) |
Form : | Lyophilized powder |
AA Sequence : | FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVNTNPRNYSYMDLNPALCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVHSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYNNVSSVWPLYPYGRCPTAADIN TPDVPICVYDPLPLILLGILLGVAVIIIVVLLLYFMVENGTRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | P33468 |
◆ Recombinant Proteins | ||
MPC1-535Z | Recombinant Zebrafish MPC1 | +Inquiry |
Bax-1381M | Recombinant Mouse BCL2-associated X Protein, GST-tagged | +Inquiry |
LSM14A-5160H | Recombinant Human LSM14A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Gp9-184R | Recombinant Rat Gp9 Protein, His-tagged | +Inquiry |
Nme5-4438M | Recombinant Mouse Nme5 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
KRT19-382H | Native Human KRT19 | +Inquiry |
LDH-217R | Active Native Rabbit Lactate Dehydrogenase | +Inquiry |
F5-1176H | Native Human Coagulation Factor V, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMP2-2061HCL | Recombinant Human TIMP2 cell lysate | +Inquiry |
GPATCH4-732HCL | Recombinant Human GPATCH4 cell lysate | +Inquiry |
GST-573SCL | Recombinant Schistosoma japonicum GST cell lysate | +Inquiry |
SELE-2992HCL | Recombinant Human SELE cell lysate | +Inquiry |
RNF113A-2308HCL | Recombinant Human RNF113A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket