Recombinant Full Length Human CAPZB Protein, GST-tagged

Cat.No. : CAPZB-2854HF
Product Overview : Human CAPZB full-length ORF (AAH08095.1, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 79 amino acids
Description : This gene encodes the beta subunit of the barbed-end actin binding protein, which belongs to the F-actin capping protein family. The capping protein is a heterodimeric actin capping protein that blocks actin filament assembly and disassembly at the fast growing (barbed) filament ends and functions in regulating actin filament dynamics as well as in stabilizing actin filament lengths in muscle and nonmuscle cells. A pseudogene of this gene is located on the long arm of chromosome 2. Multiple alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, Aug 2013]
Molecular Mass : 35.1 kDa
AA Sequence : MLNLCFMLTRHAVHSLDSFLRKLVFCSLPSSLPSPTGHITAASLTAQRHLSLRIKPIATLLRLRACFCHTSLSVLSTFP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CAPZB capping protein (actin filament) muscle Z-line, beta [ Homo sapiens ]
Official Symbol CAPZB
Synonyms CAPZB; capping protein (actin filament) muscle Z-line, beta; F-actin-capping protein subunit beta; capZ beta; CAPB; CAPZ; CAPPB; FLJ12274; FLJ44693; MGC104401; MGC129749; MGC129750; DKFZp686K0524;
Gene ID 832
mRNA Refseq NM_001206540
Protein Refseq NP_001193469
MIM 601572
UniProt ID P47756

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CAPZB Products

Required fields are marked with *

My Review for All CAPZB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon