Recombinant Full Length Human CAPZB Protein, GST-tagged
Cat.No. : | CAPZB-2854HF |
Product Overview : | Human CAPZB full-length ORF (AAH08095.1, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes the beta subunit of the barbed-end actin binding protein, which belongs to the F-actin capping protein family. The capping protein is a heterodimeric actin capping protein that blocks actin filament assembly and disassembly at the fast growing (barbed) filament ends and functions in regulating actin filament dynamics as well as in stabilizing actin filament lengths in muscle and nonmuscle cells. A pseudogene of this gene is located on the long arm of chromosome 2. Multiple alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, Aug 2013] |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 35.1 kDa |
Protein length : | 79 amino acids |
AA Sequence : | MLNLCFMLTRHAVHSLDSFLRKLVFCSLPSSLPSPTGHITAASLTAQRHLSLRIKPIATLLRLRACFCHTSLSVLSTFP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CAPZB capping protein (actin filament) muscle Z-line, beta [ Homo sapiens ] |
Official Symbol | CAPZB |
Synonyms | CAPZB; capping protein (actin filament) muscle Z-line, beta; F-actin-capping protein subunit beta; capZ beta; CAPB; CAPZ; CAPPB; FLJ12274; FLJ44693; MGC104401; MGC129749; MGC129750; DKFZp686K0524; |
Gene ID | 832 |
mRNA Refseq | NM_001206540 |
Protein Refseq | NP_001193469 |
MIM | 601572 |
UniProt ID | P47756 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAPZB Products
Required fields are marked with *
My Review for All CAPZB Products
Required fields are marked with *
0
Inquiry Basket