Recombinant Human CAPZB protein, GST-tagged
Cat.No. : | CAPZB-2633H |
Product Overview : | Recombinant Human CAPZB protein(P47756)(1-272aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-272aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 57.6 kDa |
AA Sequence : | MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CAPZB capping protein (actin filament) muscle Z-line, beta [ Homo sapiens ] |
Official Symbol | CAPZB |
Synonyms | CAPZB; capping protein (actin filament) muscle Z-line, beta; F-actin-capping protein subunit beta; capZ beta; CAPB; CAPZ; CAPPB; FLJ12274; FLJ44693; MGC104401; MGC129749; MGC129750; DKFZp686K0524; |
Gene ID | 832 |
mRNA Refseq | NM_001206540 |
Protein Refseq | NP_001193469 |
MIM | 601572 |
UniProt ID | P47756 |
◆ Recombinant Proteins | ||
CAPZB-1130R | Recombinant Rat CAPZB Protein | +Inquiry |
CAPZB-6987C | Recombinant Chicken CAPZB | +Inquiry |
CAPZB-26238TH | Recombinant Human CAPZB, His-tagged | +Inquiry |
CAPZB-2484H | Recombinant Human CAPZB Protein, MYC/DDK-tagged | +Inquiry |
CAPZB-2854HF | Recombinant Full Length Human CAPZB Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPZB-281HCL | Recombinant Human CAPZB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAPZB Products
Required fields are marked with *
My Review for All CAPZB Products
Required fields are marked with *
0
Inquiry Basket