Recombinant Human CAPZB, His-tagged

Cat.No. : CAPZB-26238TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-272 of Human CAPZB with N terminal His tag, 34kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-272 a.a.
Description : This gene encodes the beta subunit of the barbed-end actin binding protein, which belongs to the F-actin capping protein family. The capping protein is a heterodimeric actin capping protein that blocks actin filament assembly and disassembly at the fast growing (barbed) filament ends and functions in regulating actin filament dynamics as well as in stabilizing actin filament lengths in muscle and nonmuscle cells. Multiple alternatively spliced transcript variants encoding different isoforms have been found.
Conjugation : HIS
Form : Lyophilised:For lot 903131, please reconstitute with 148 μl aqua dest.For lot 935335 and above, please reconstitute with 155 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLL SSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNK YDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSS VYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEV QEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLT RQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFG KTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
Sequence Similarities : Belongs to the F-actin-capping protein beta subunit family.
Full Length : Full L.
Gene Name CAPZB capping protein (actin filament) muscle Z-line, beta [ Homo sapiens ]
Official Symbol CAPZB
Synonyms CAPZB; capping protein (actin filament) muscle Z-line, beta; F-actin-capping protein subunit beta;
Gene ID 832
mRNA Refseq NM_001206540
Protein Refseq NP_001193469
MIM 601572
Uniprot ID P47756
Chromosome Location 1p36.1
Pathway Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function actin binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CAPZB Products

Required fields are marked with *

My Review for All CAPZB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon