Recombinant Human AGPAT3 Protein, GST-tagged

• Cat.No.: AGPAT3-430H
• Product Overview: Human AGPAT3 full-length ORF ( AAH04219.1, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 33.7 kDa
• AA Sequence: MGSPAHLPKDAIAVFIVFPRVRHWLSGTRRQCTRRAPYVRCFKVPVLRKRSLVEEMSAEQITK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AGPAT3 1-acylglycerol-3-phosphate O-acyltransferase 3 [ Homo sapiens ]
• Official Symbol: AGPAT3
• Synonyms: AGPAT3; 1-acylglycerol-3-phosphate O-acyltransferase 3; 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma; LPAAT gamma; 1-AGPAT 3; 1-AGP acyltransferase 3; lysophosphatidic acid acyltransferase gamma; lysophosphatidic acid acyltransferase-gamma1; LPAAT-GAMMA1; MGC4604
• Gene ID: 56894
• mRNA Refseq: NM_001037553
• Protein Refseq: NP_001032642
• MIM: 614796
• UniProt ID: Q9NRZ7