Recombinant Full Length Histidine-Rich Membrane Protein Ke4 Homolog 1(Hke-4.1) Protein, His-Tagged
Cat.No. : | RFL9211CF |
Product Overview : | Recombinant Full Length Histidine-rich membrane protein KE4 homolog 1(hke-4.1) Protein (A8WMY3) (1-392aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis briggsae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-392) |
Form : | Lyophilized powder |
AA Sequence : | MRLLTVVLLLPLLIICHEHSHHHHDDEGSAVLTKVGLDDHELHEHDHDHDHDHKILRWDE KKNHSSHEKVPHSQLSTLKVWVFSLSAVIGISLAPCTLLFFIPAQHANGPFLKILLAFGA GGLLGDALLHIIPHSLNPHSHGAHDHDHAHSHDHAHNDHSHDHSDQLRVGIYVIAGILVF MMVEQLVRIIKGGHCHSHENGHIVADEHRHLNDDHHHHHNGEKKQEVEGLKDIKASAYLN LVADFVHNMTDGLAIGASFSAGSTLGWVTTLTVLLHELPHEVGDFAILVQSGFSKYQAIR MQAVTALGAITGCIFSLLISNPVLSAEGDTGAIMPFTAGGFIYIATVSVIPELLESGDHN NMSKVAKMAQSLVHLIAICMGVGMMYIVSLVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hke-4.1 |
Synonyms | zipt-7.1; hke-4.1; CBG00379; Zinc transporter zipt-7.1; Histidine-rich membrane protein KE4 homolog 1 |
UniProt ID | A8WMY3 |
◆ Recombinant Proteins | ||
HSP90AA1-1461H | Recombinant Human HSP90AA1, His-tagged | +Inquiry |
PLA2G7-1145H | Active Recombinant Human PLA2G7 protein(Met1-Asn441), His-tagged | +Inquiry |
RFL26010MF | Recombinant Full Length Mycoplasma Gallisepticum P32 Adhesin(Mgc2) Protein, His-Tagged | +Inquiry |
KIF4A-6534C | Recombinant Chicken KIF4A | +Inquiry |
RFL17314LF | Recombinant Full Length Lactuca Sativa Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CAPN1-65P | Active Native Porcine Porcine Calpain 1 | +Inquiry |
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
PerCP-02D | Native Dinophyceae sp. PerCP Protein | +Inquiry |
Lectin-1797L | Active Native Lotus Tetragonolobus Lectin Protein, Biotinylated | +Inquiry |
HGF-29231TH | Native Human HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINA5-1940HCL | Recombinant Human SERPINA5 293 Cell Lysate | +Inquiry |
IAH1-5320HCL | Recombinant Human IAH1 293 Cell Lysate | +Inquiry |
RANGAP1-2532HCL | Recombinant Human RANGAP1 293 Cell Lysate | +Inquiry |
IYD-885HCL | Recombinant Human IYD cell lysate | +Inquiry |
ADAM2-22HCL | Recombinant Human ADAM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hke-4.1 Products
Required fields are marked with *
My Review for All hke-4.1 Products
Required fields are marked with *
0
Inquiry Basket