Recombinant Full Length Shewanella Oneidensis Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL29182SF |
Product Overview : | Recombinant Full Length Shewanella oneidensis Apolipoprotein N-acyltransferase(lnt) Protein (Q8EHP1) (1-518aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella oneidensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-518) |
Form : | Lyophilized powder |
AA Sequence : | MLTNIRAFAQQKSRLSALRLVLAFILGASTALSFAPYSLWIIYPIAMSLALWQSESLNPK ASFFHWLSFGFGCFAVGISWVHVSMDTFGGLPLPASVALMALLALYLALYPALTGLGLAW FTRTNSHSLWRNLLLFPALWTLTEWARGWVLTGFPWIWAGYSQTEGPLKALASIIGALGL SFIIAMIAGALALCFSKRYKSLLILLPITAVAAWVAPKLSQIQPTGESVKVALVQGNIPQ SMKWEPEALWPTLLKYMDLSREHFDADIIVWPEAAIPAPESMVQDFLDNANKVANLNHTS IITGIISRQQEDFYNSLIVLGNHNQKQQDNPDYESDGSNQFKKHHLLPIGEFVPFQALLR PIAPFFNLPMSSFARGDYLQPNLSALGHKVAPAICYEIAFPEQLRDSVNLGTDLLLTVSN DAWFGTSNGPLQHMEIAQMRAIELGRPLVRATNNGVTAVVDENGNITAALPQFETGVLSA TIPLVTGQTWFAKIGQTPLLILCGALLLVGFIRRQKQQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; SO_1177; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q8EHP1 |
◆ Recombinant Proteins | ||
Defb14-68M | Recombinant Mouse Defb14 protein | +Inquiry |
KAP1-220H | Recombinant Human KAP1, His-tagged | +Inquiry |
DSG1-0269H | Recombinant Human DSG1 Protein, Tag Free | +Inquiry |
UNC5C-164H | Recombinant Human UNC5C Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL35586PF | Recombinant Full Length Pseudomonas Fluorescens Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CLU-67H | Native Human Clusterin | +Inquiry |
F9-301R | Native Rat Factor IXa | +Inquiry |
CGB-8048H | Native Human Urine Beta Chorionic Gonadotropin (b-hCG) | +Inquiry |
CXCL1-27707TH | Native Human CXCL1 | +Inquiry |
PNLIP-8205H | Native Human Pancreas Lipase | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM28-2475HCL | Recombinant Human RBM28 293 Cell Lysate | +Inquiry |
C5orf34-8013HCL | Recombinant Human C5orf34 293 Cell Lysate | +Inquiry |
PSMG1-2736HCL | Recombinant Human PSMG1 293 Cell Lysate | +Inquiry |
SkeletalMuscles-496C | Chicken Skeletal Muscles Lysate, Total Protein | +Inquiry |
ORAI2-3554HCL | Recombinant Human ORAI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket