Recombinant Full Length Vibrio Cholerae Serotype O1 Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL26699VF |
Product Overview : | Recombinant Full Length Vibrio cholerae serotype O1 Apolipoprotein N-acyltransferase(lnt) Protein (Q9KTE4) (1-505aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio cholerae serotype O1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-505) |
Form : | Lyophilized powder |
AA Sequence : | MNSVLSHRLMRPLAAAFVGVITPLAFAPYQFWPLALLSPFILLLLLHQQSAKRAALIAYL WGIGQFAVGISWVHVSIDTFGGMPKIASLFLMTLLVGYLALYPSLFGWLLNRLFPNNSRS KWLCAAPALWLITDWLRGWVMTGFPWLWLGYSQIDSPLANFAPIGGVELITLLLLFCAGS LAYAVLNRRWLMACIPLVVYATGYGLQAMQWVTPQTERTASLALIQGNIEQGLKWLPSQR WPTIMKYTDLTRENWDADVIIWPEAAIPAFEYEISSFLHNLDAAARMNQSAVITGIINQS DDKQYFNSVLTVGDTPHGEYRYDLTQRYHKYHLLPFGEFVPFEEILRPLAPFFNLPMSSF SQGAYVQPNLIAKGFAFVTALCYEIIFNEQVRDNVTPDTDFLLTLSNDAWFGRSIGPLQH MEIARMRALELGKPLIRATNNGVTAVTDERGRIMAQLPQFETGVLKATVTPTRGSTPYFL WGTTPLYLWVGLAAGFAFWRQRRAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; VC_0958; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q9KTE4 |
◆ Recombinant Proteins | ||
PDGFRB-1208RAF555 | Recombinant Monkey PDGFRB Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
N-3854V | Recombinant Vesicular stomatitis Indiana virus N protein, His&Myc-tagged | +Inquiry |
TMEM106A-5763R | Recombinant Rat TMEM106A Protein, His (Fc)-Avi-tagged | +Inquiry |
APLNR-6124H | Recombinant Human APLNR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Gck-748M | Recombinant Mouse Gck protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
PLG-27842TH | Native Human PLG | +Inquiry |
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
CASQ2-30C | Native Canine CASQ2 | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST6GAL1-1919HCL | Recombinant Human ST6GAL1 cell lysate | +Inquiry |
SOCS5-1579HCL | Recombinant Human SOCS5 293 Cell Lysate | +Inquiry |
STATH-785HCL | Recombinant Human STATH cell lysate | +Inquiry |
KRTAP10-4-4856HCL | Recombinant Human KRTAP10 293 Cell Lysate | +Inquiry |
BTC-2505MCL | Recombinant Mouse BTC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket