Recombinant Full Length Geobacter Metallireducens Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL12516GF |
Product Overview : | Recombinant Full Length Geobacter metallireducens Apolipoprotein N-acyltransferase(lnt) Protein (Q39T32) (1-521aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Geobacter metallireducens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-521) |
Form : | Lyophilized powder |
AA Sequence : | MDYRRLRMPDFDAIPRRDYLMAVLSGVLLALSFPSPGISPLAWIAFAPLLLACGRKDPRK AFRLGFVTGLAAYAGILYWITIVVTTYGKLPWIVSVGVLSMLVSYLALYPAVVAYLVRRG EERGISLLISFPLLWVGLEYGRAFLVTGFPWASLGYTQYRTLPLIQIADITGVYGLSFLI ALANVVLFRIIRGFAAREPAPYPVKSVVLLLVLLLVTIAYGFKRLHVPEGGAPFKVALIQ GNIDQNIKWDPSFQEETVAIYERLSRKACAAGPSDLLVWPESAAPFYFQDEPRYASRIKG LARELKTCAVVGSPAFEKDGERLKYLNSAFLLSPWGDVIGRSDKIHLVPFGEYVPMAKLL PFVNKLVAGIGDFSPGAQIAALDTGKGRIGILVCFEGIFPELSRAYVRAGSRLLVNITND AWFGRSSAPYQHISMTVFRAVENRVPLVRAANTGITSIIDSRGHIRGMTPLFQEAVLNGE VRLGEGESFYNRYGDVFAWACVAGAAVVAALAFRRKSIHHQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; Gmet_2367; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q39T32 |
◆ Recombinant Proteins | ||
bla-5637E | Recombinant Escherichia coli bla protein, His-tagged | +Inquiry |
ABHD6-11H | Recombinant Human ABHD6 Protein, C-Myc/DDK-tagged | +Inquiry |
NOTCH2-721HB | Recombinant Human NOTCH2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
CENPW-1046H | Recombinant Human CENPW | +Inquiry |
HSDL1-1272C | Recombinant Chicken HSDL1 | +Inquiry |
◆ Native Proteins | ||
CGA-8163H | Native Human Chorionic Gonadotropin | +Inquiry |
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
Collagen Type I-03R | Native Rat Collagen Type I (Atelocollagen) Protein | +Inquiry |
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM190A-6394HCL | Recombinant Human FAM190A 293 Cell Lysate | +Inquiry |
NLGN3-2082HCL | Recombinant Human NLGN3 cell lysate | +Inquiry |
NDUFC2-3899HCL | Recombinant Human NDUFC2 293 Cell Lysate | +Inquiry |
SRC-487HCL | Recombinant Human SRC cell lysate | +Inquiry |
IL1RL1-001MCL | Recombinant Mouse IL1RL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket