Recombinant Full Length Geobacillus Thermodenitrificans Cardiolipin Synthase(Cls) Protein, His-Tagged
Cat.No. : | RFL17191GF |
Product Overview : | Recombinant Full Length Geobacillus thermodenitrificans Cardiolipin synthase(cls) Protein (A4IL76) (1-502aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Geobacillus thermodenitrificans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-502) |
Form : | Lyophilized powder |
AA Sequence : | MRNTSRVAILIVIVGVLLTLTHDYWGGKLLGIFSVLISCSVVFIAFVISLENRKPAQTIA WLAVLGSFPFLGFLFYLLFGRNYWQQRRFKKKAESDEAVLLKFQEPSPIAIERLPMAPHQ RPLLHLAYRIGQHPVSLASQTAVLTNGEETFAAIFDELEKAQHHIHLEYYIVRHDEIGQK LKHVLMEKACQGVHVRFLYDAVGSWKLSNAYIEELRAAGVEMIPFSPVRLPFLSNQINFR NHRKIIVIDGGVGFVGGLNIGDEYLGKDEYFGFWRDTHLLIRGEAVRTLQLIFLQDWYYM TGERLLTPEYLSPPLIVEEGQGGVQLIAGGPDQKWEVIKQLYFAMITSAKRSIWVASPYF VPDEDILTALKVAALSGIDVRLLAPKRPDKKIVFYASRSYFPELLEAGVKIYEYEKGFLH SKVIVVDGELASIGTANMDMRSFHLNFEVNAFLYYTDSTNKLVNDFLEDFRHASPIDYVQ FQQRPFRVRIVESVSRLLSPLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls |
Synonyms | cls; GTNG_0700; Cardiolipin synthase; CL synthase |
UniProt ID | A4IL76 |
◆ Native Proteins | ||
BSI-B4-852 | Active Native Bandeiraea simplicifolia Isolectin B4 protein | +Inquiry |
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
20S Immunoproteasome-225C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
HSV-2ag-268V | Active Native HSV-2 Protein | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFEB-1128HCL | Recombinant Human TFEB 293 Cell Lysate | +Inquiry |
RBP4-2863HCL | Recombinant Human RBP4 cell lysate | +Inquiry |
WTAP-277HCL | Recombinant Human WTAP 293 Cell Lysate | +Inquiry |
PARP1-710HCL | Recombinant Human PARP1 cell lysate | +Inquiry |
PINK1-3929HCL | Recombinant Human PINK1 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cls Products
Required fields are marked with *
My Review for All cls Products
Required fields are marked with *
0
Inquiry Basket