Recombinant Full Length Bacillus Halodurans Cardiolipin Synthase(Cls) Protein, His-Tagged
Cat.No. : | RFL8556BF |
Product Overview : | Recombinant Full Length Bacillus halodurans Cardiolipin synthase(cls) Protein (Q9K8Z4) (1-503aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Halodurans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-503) |
Form : | Lyophilized powder |
AA Sequence : | MKNRLNVLLFLLILSTGLYLTRSFWQGWIVGAFSVLITITVVFIGIVIFLENRHPTKTLT WLMVLAVFPVVGFIFYLMFGQNHRKSKTFMKKALSDEEAFEKIEGNRQLNEEQLQKMGGH QQLLFRLAHRLANNPISFSTNTKVLTDGKETFAHIKQALRMATHHIHLEYYIVRDDEIGQ EIKEILMQKAKEGIHVRFLYDGVGSWKLSKSYIQDLKQAGVEIVPFAPVKLPFINHTINY RNHRKIIVIDGTVGFVGGLNIGDEYLGKDPYFGFWRDTHLYVRGEAVRTLQLIFLRDWAH ETGETILKPSYLSPALTNMKDDGGVQMIASGPDTRWEINKKLFFSMITSAKKSIWITSPY FIPDEDILSALKIAALSGIDVRILVPNRPDKRIVFHASRSYFPELLEAGVKVYEYTRGFL HSKIIIVDNEIASIGTSNMDMRSFHLNFEVNAFLYRTKSVTTLVSDFVYDLEHTNQIRFE QFRNRAWYYRVLESTCRLLSPLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls |
Synonyms | cls; BH2858; Cardiolipin synthase; CL synthase |
UniProt ID | Q9K8Z4 |
◆ Recombinant Proteins | ||
RNF10-14282M | Recombinant Mouse RNF10 Protein | +Inquiry |
APLP1-1102H | Recombinant Human APLP1 protein(Met1-Glu580), His-tagged | +Inquiry |
NOS3-7858P | Recombinant Pig NOS3 protein, His-tagged | +Inquiry |
SHB-8139M | Recombinant Mouse SHB Protein, His (Fc)-Avi-tagged | +Inquiry |
DIRAS3-0267H | Recombinant Human DIRAS3 protein, mFc-tagged | +Inquiry |
◆ Native Proteins | ||
LDH3-22H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
PIV3-20 | Native Parainfluenza Virus Type 3 Antigen | +Inquiry |
Histone-52C | Native Calf Histone | +Inquiry |
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
ALB-4783D | Native Dog Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2BFWT-315HCL | Recombinant Human H2BFWT lysate | +Inquiry |
HIST1H2AK-325HCL | Recombinant Human HIST1H2AK lysate | +Inquiry |
AGXT-8967HCL | Recombinant Human AGXT 293 Cell Lysate | +Inquiry |
ALX4-8889HCL | Recombinant Human ALX4 293 Cell Lysate | +Inquiry |
TMEM167A-994HCL | Recombinant Human TMEM167A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cls Products
Required fields are marked with *
My Review for All cls Products
Required fields are marked with *
0
Inquiry Basket